PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC19071_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bHLH
Protein Properties Length: 188aa    MW: 21883.3 Da    PI: 8.1126
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC19071_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH45.31.6e-142576255
                 HHHHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
          HLH  2 rrahnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55
                 +++h e+Er+RR+++ s ++ Lr+llP ++   ++K s ++ + +Av+YI++L+
  RrC19071_p1 25 KMMHREIERQRRQEMASLYASLRSLLPLNF--IQGKRSTSDQVGEAVNYIRYLE 76
                 789*************************75..********************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088814.2592375IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000101.6E-112576IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.101.2E-102589IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000837.24E-92580No hitNo description
SuperFamilySSF474596.8E-142591IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003536.8E-72981IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 188 aa     Download sequence    Send to blast
MDDCREKRRR CTKLRVSTDN NDMEKMMHRE IERQRRQEMA SLYASLRSLL PLNFIQGKRS  60
TSDQVGEAVN YIRYLERKIK ELSLRRDELM LLSRGTLLDD SKNEMEAINH VVVRQCLVGV  120
EIVFSSRCCR GQPQLSSVLQ VLSENGLCLL NTISSIVDDR LIYTIQAEVK DSTLIDLSEL  180
EERLTRMK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3174309e-70AK317430.1 Arabidopsis thaliana AT5G51780 mRNA, complete cds, clone: RAFL24-28-D24.
GenBankBT0109529e-70BT010952.1 Arabidopsis thaliana At5g51780 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013674763.11e-122PREDICTED: transcription factor bHLH36-like
RefseqXP_013710558.11e-122PREDICTED: transcription factor bHLH36-like
SwissprotQ9FLI18e-90BH036_ARATH; Transcription factor bHLH36
TrEMBLA0A078IC521e-122A0A078IC52_BRANA; BnaAnng08070D protein
STRINGBra022562.1-P1e-122(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM44792754
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G51780.15e-91bHLH family protein